貨號CYT-394 重組大鼠白介素-1β

Catalogue Number CYT-394 Synonyms Catabolin, L

Catalogue Number	CYT-394
Synonyms	Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Introduction	Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Description	Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 152 amino acids and having a molecular mass of 17.3 kDa. The IL-1b is purified by proprietary chromatographic techniques.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	The protein was lyophilized without any additives.
Solubility	It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability	Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Purity	Greater than 95.0% as determined by SDS-PAGE.
Amino acid sequence	VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSND KIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKT KVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
Biological Activity	The ED50 range= 0.2-0.5 ng/ml corresponding to a specific activity of 2-5MIU/mg determined by the dose dependent proliferation of mouse D10S cells.
Protein content	Protein quantitation was carried out by two independent methods 1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products	» IL 1 Beta Antibody » IL 1 Beta Antibody, Biotin » IL 1 Beta Antibody, FITC » IL 1 beta Human » IL 1 beta Human, His » IL 1 beta Mon key » IL 1 beta Mouse » IL 1 beta Mouse, His » IL 1 beta Porcine

Catalogue Number	CYT-394
Synonyms	Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Introduction	Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Description	Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 152 amino acids and having a molecular mass of 17.3 kDa. The IL-1b is purified by proprietary chromatographic techniques.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	The protein was lyophilized without any additives.
Solubility	It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability	Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Purity	Greater than 95.0% as determined by SDS-PAGE.
Amino acid sequence	VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSND KIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKT KVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
Biological Activity	The ED50 range= 0.2-0.5 ng/ml corresponding to a specific activity of 2-5MIU/mg determined by the dose dependent proliferation of mouse D10S cells.
Protein content	Protein quantitation was carried out by two independent methods 1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products	» IL 1 Beta Antibody » IL 1 Beta Antibody, Biotin » IL 1 Beta Antibody, FITC » IL 1 beta Human » IL 1 beta Human, His » IL 1 beta Mon key » IL 1 beta Mouse » IL 1 beta Mouse, His » IL 1 beta Porcine

本頁產(chǎn)品地址：http://m.bhxfsw.cn/sell/show-183799.html